PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D12G1271
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 240aa    MW: 27178.5 Da    PI: 6.3587
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D12G1271genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.42.4e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +grWT eEde+l ++++  G g+W++ ++  g+ R++k+c++rw +yl
      Gh_D12G1271 14 KGRWTDEEDEILTKYIQVNGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding55.71.2e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+ Ede +v+++  lG++ W++Ia++++ gRt++++k++w+ +
      Gh_D12G1271  67 RGNFTAKEDETIVNLHSTLGNR-WSLIASHLP-GRTDNEIKNYWNAH 111
                      89********************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-21564IPR009057Homeodomain-like
PROSITE profilePS5129416.359961IPR017930Myb domain
SuperFamilySSF466894.4E-2911108IPR009057Homeodomain-like
SMARTSM007174.3E-121363IPR001005SANT/Myb domain
PfamPF002494.4E-141461IPR001005SANT/Myb domain
CDDcd001674.57E-91661No hitNo description
PROSITE profilePS5129423.18862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-2565116IPR009057Homeodomain-like
SMARTSM007175.1E-1666114IPR001005SANT/Myb domain
PfamPF002491.3E-1567112IPR001005SANT/Myb domain
CDDcd001671.91E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MGRAPCCEKV GLKKGRWTDE EDEILTKYIQ VNGEGSWRSL PKNAGLLRCG KSCRLRWINY  60
LRTDLERGNF TAKEDETIVN LHSTLGNRWS LIASHLPGRT DNEIKNYWNA HLSRKIYRWA  120
MKKNKSCCFN AHKDAISSSN KPMEVVPVIP SHSGSEEERN MENISRPNSS SCNTEKETGS  180
EDIWEPCSKD IMGSELLPPN DDLSLSGYGE NSIGDDLNPI TSCFVDDDLF GILRKFSSRE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A4e-24121162105MYB PROTO-ONCOGENE PROTEIN
1h8a_C5e-241211625128MYB TRANSFORMING PROTEIN
1mse_C4e-24121162105C-Myb DNA-Binding Domain
1msf_C4e-24121162105C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012435708.11e-174PREDICTED: transcription factor MYB12-like
RefseqXP_012435709.11e-174PREDICTED: transcription factor MYB12-like
SwissprotO222648e-68MYB12_ARATH; Transcription factor MYB12
TrEMBLA0A0D2RF121e-174A0A0D2RF12_G
STRINGGLYMA02G01740.14e-69(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49330.14e-72myb domain protein 111